- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
VIP, human
Vasoactive intestinal peptide
28 aa · 3325.85 g/mol · ≥95% (HPLC)
About this peptide
28-residue secretin-family peptide acting at VPAC1 and VPAC2.
Reported research uses
- 01VPAC receptor pharmacology
- 02Immune and circadian research
Specifications
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Length
- 28 residues
- Molecular formula
- C₁₄₇H₂₃₈N₄₄O₄₂S
- Molecular weight
- 3325.85 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Vasoactive intestinal polypeptide
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.