- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 197922-42-2Enhanced verificationMade to order · 2–6 weeks
Teduglutide
[Gly2]-GLP-2, DPP-4 resistant
33 aa · 3752.1 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
GLP-2 analogue with Ala2→Gly, resistant to DPP-4 cleavage.
Reported research uses
- 01Long-acting GLP-2R agonist studies
- 02Intestinal adaptation research models
Specifications
- CAS number
- 197922-42-2
- Sequence
- HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
- Length
- 33 residues
- Molecular formula
- C₁₆₄H₂₅₂N₄₄O₅₅S
- Molecular weight
- 3752.1 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- ALX-0600; [Gly2]GLP-2
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.