- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 86168-78-7Enhanced verificationMade to order · 2–6 weeks
Sermorelin
GHRH (1-29) amide
29 aa · 3357.9 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
The shortest fully active fragment of growth-hormone releasing hormone.
Reported research uses
- 01GHRH receptor reference agonist
- 02Pituitary somatotroph research
Specifications
- CAS number
- 86168-78-7
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Length
- 29 residues
- Molecular formula
- C₁₄₉H₂₄₆N₄₄O₄₂S
- Molecular weight
- 3357.9 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- GRF 1-29 NH2; GHRH(1-29)
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.