- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 52232-67-4StandardMade to order · 2–6 weeks
PTH (1-34), human
Parathyroid hormone N-terminal fragment
34 aa · 4118 g/mol · ≥95% (HPLC)
About this peptide
Fully active N-terminal PTH fragment acting at PTH1R.
Reported research uses
- 01PTH1R signalling
- 02Bone formation research models
Specifications
- CAS number
- 52232-67-4
- Sequence
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- Length
- 34 residues
- Molecular formula
- C₁₈₁H₂₉₁N₅₅O₅₁S₂
- Molecular weight
- 4118 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Teriparatide sequence; hPTH(1-34)
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.