- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
PACAP-38
Pituitary adenylate cyclase-activating polypeptide
38 aa · 4534 g/mol · ≥95% (HPLC)
About this peptide
38-residue PAC1/VPAC agonist with potent cAMP activation.
Reported research uses
- 01PAC1 receptor signalling
- 02Neuroprotection and migraine research
Specifications
- Sequence
- HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- Length
- 38 residues
- Molecular formula
- C₂₀₃H₃₃₁N₆₃O₅₃S
- Molecular weight
- 4534 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- PACAP (1-38)
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.