- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideEnhanced verificationMade to order · 2–6 weeks
Oxyntomodulin, human
Native glucagon / GLP-1 co-agonist
37 aa · 4449.90 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
37-residue proglucagon peptide: glucagon extended by an octapeptide, with dual GCGR and GLP-1R activity.
Reported research uses
- 01Dual-agonist reference for GCGR/GLP-1R
- 02Appetite and energy-balance research
Specifications
- Sequence
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
- Length
- 37 residues
- Molecular formula
- C₁₉₂H₂₉₅N₆₁O₆₀S
- Molecular weight
- 4449.90 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- OXM; Glucagon-37
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.