- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
Neuropeptide Y, human
36-residue PP-fold neuropeptide
36 aa · 4271.75 g/mol · ≥95% (HPLC)
About this peptide
Abundant brain neuropeptide acting at Y1, Y2, Y4 and Y5 receptors.
Reported research uses
- 01Y-receptor pharmacology
- 02Feeding and stress research
Specifications
- Sequence
- YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
- Length
- 36 residues
- Molecular formula
- C₁₈₉H₂₈₅N₅₅O₅₇S
- Molecular weight
- 4271.75 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- NPY
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.