- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 223460-79-5Enhanced verificationMade to order · 2–6 weeks
GLP-2, human
Glucagon-like peptide 2 (1-33)
33 aa · 3766.1 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
Intestinotrophic proglucagon-derived peptide acting on the GLP-2 receptor.
Reported research uses
- 01GLP-2R signalling
- 02Intestinal epithelium and barrier research
Specifications
- CAS number
- 223460-79-5
- Sequence
- HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Length
- 33 residues
- Molecular formula
- C₁₆₅H₂₅₄N₄₄O₅₅S
- Molecular weight
- 3766.1 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Glucagon-like peptide 2
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.