- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideEnhanced verificationMade to order · 2–6 weeks
GLP-1 (7-36) amide, human
Endogenous active GLP-1
30 aa · 3297.68 g/mol · ≥98% (HPLC)
Verified orders. Each order needs institutional verification and a signed end-use statement before it ships. Orders above typical research quantities are reviewed first. Why
About this peptide
The main circulating active form of glucagon-like peptide-1. Native reference agonist and DPP-4 substrate.
Reported research uses
- 01Native GLP-1R agonist reference
- 02DPP-4 degradation assays
Specifications
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- Length
- 30 residues
- Molecular formula
- C₁₄₉H₂₂₆N₄₀O₄₅
- Molecular weight
- 3297.68 g/mol
- Purity
- ≥98% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Glucagon-like peptide 1 (7-36) amide
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.