- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 133514-43-9StandardMade to order · 2–6 weeks
Exendin (9-39)
GLP-1 receptor antagonist
31 aa · 3369.8 g/mol · ≥95% (HPLC)
About this peptide
N-terminally truncated exendin-4, the standard competitive antagonist at the GLP-1 receptor.
Reported research uses
- 01Blocking endogenous GLP-1 signalling
- 02Incretin-effect dissection in vivo
Specifications
- CAS number
- 133514-43-9
- Sequence
- DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- Length
- 31 residues
- Molecular formula
- C₁₄₉H₂₃₄N₄₀O₄₇S
- Molecular weight
- 3369.8 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Exendin 9-39 amide; GLP-1R antagonist
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.