- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 9015-71-8StandardMade to order · 2–6 weeks
CRF, human/rat
Corticotropin-releasing factor
41 aa · 4757 g/mol · ≥95% (HPLC)
About this peptide
41-residue hypothalamic peptide initiating the HPA stress response.
Reported research uses
- 01CRF1/CRF2 receptor assays
- 02Stress-axis research
Specifications
- CAS number
- 9015-71-8
- Sequence
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- Length
- 41 residues
- Molecular formula
- C₂₀₈H₃₄₄N₆₀O₆₃S₂
- Molecular weight
- 4757 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- CRH; Corticoliberin
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.