- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 80451-04-3StandardMade to order · 2–6 weeks
Cecropin A
Silk moth antimicrobial peptide
37 aa · 4004 g/mol · ≥95% (HPLC)
About this peptide
37-residue insect host-defence peptide.
Reported research uses
- 01Gram-negative antimicrobial assays
Specifications
- CAS number
- 80451-04-3
- Sequence
- KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
- Length
- 37 residues
- Molecular formula
- C₁₈₄H₃₁₃N₅₃O₄₆
- Molecular weight
- 4004 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Cecropin A (Hyalophora cecropia)
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.