- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
BNP-32, human
Brain natriuretic peptide
32 aa · 3464 g/mol · ≥95% (HPLC)
About this peptide
Ventricular natriuretic peptide and immunoassay calibrant.
Reported research uses
- 01Heart-failure biomarker assay standards
- 02NPR-A signalling
Specifications
- Sequence
- SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Length
- 32 residues
- Molecular formula
- C₁₄₃H₂₄₄N₅₀O₄₂S₄
- Molecular weight
- 3464 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- B-type natriuretic peptide; Nesiritide sequence
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.