- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
β-Endorphin, human
31-residue POMC opioid peptide
31 aa · 3465.03 g/mol · ≥95% (HPLC)
About this peptide
μ-opioid agonist derived from pro-opiomelanocortin.
Reported research uses
- 01μ-opioid receptor assays
- 02Stress and analgesia research
Specifications
- Sequence
- YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
- Length
- 31 residues
- Molecular formula
- C₁₅₈H₂₅₁N₃₉O₄₆S
- Molecular weight
- 3465.03 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- β-EP
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.