- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
Amyloid β (42-1), human
Reverse-sequence control
42 aa · 4514.11 g/mol · ≥95% (HPLC)
About this peptide
Aβ42 in reverse order: same composition, no fibril-forming activity. Negative control for Aβ42 experiments.
Reported research uses
- 01Negative control for Aβ42 toxicity and aggregation
Specifications
- Sequence
- AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
- Length
- 42 residues
- Molecular formula
- C₂₀₃H₃₁₁N₅₅O₆₀S
- Molecular weight
- 4514.11 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- Reverse Aβ42; Aβ42-1
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.