- Basic
- Aromatic
- Nonpolar
- Polar
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
PeptideStandardMade to order · 2–6 weeks
Amylin, human
Islet amyloid polypeptide (IAPP)
37 aa · 3903.32 g/mol · ≥95% (HPLC)
About this peptide
37-residue amidated pancreatic hormone with a Cys2–Cys7 disulfide; forms islet amyloid.
Reported research uses
- 01Islet amyloid formation assays
- 02Amylin receptor pharmacology
Specifications
- Sequence
- KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
- Length
- 37 residues
- Molecular formula
- C₁₆₅H₂₆₁N₅₁O₅₅S₂
- Molecular weight
- 3903.32 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- IAPP; hIAPP
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.