- Basic
- Aromatic
- Nonpolar
- Polar
- Acidic
Backbone, N to C · one bead per residue
Too many residues to draw atom by atom at this size.
CAS 148498-78-6StandardMade to order · 2–6 weeks
Adrenomedullin (1-52), human
CGRP-family vasodilator peptide
52 aa · 6029 g/mol · ≥95% (HPLC)
About this peptide
52-residue peptide acting at CLR/RAMP2 and RAMP3 receptor complexes.
Reported research uses
- 01AM1/AM2 receptor assays
- 02Vascular and sepsis research
Specifications
- CAS number
- 148498-78-6
- Sequence
- YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
- Length
- 52 residues
- Molecular formula
- C₂₆₄H₄₀₆N₈₀O₇₇S₃
- Molecular weight
- 6029 g/mol
- Purity
- ≥95% (HPLC)
- Counter-ion
- TFA (acetate on request)
- Appearance
- Lyophilised white powder
- Storage
- −20 °C, desiccated, protected from light
- Synonyms
- AM; ADM
Values from the manufacturer’s documents; the lot CoA is the reference. For laboratory research use only — not for human or veterinary use. Synthesised after your order is verified; MS and HPLC data come with the lot.